3dtd/3/1:K/1:L

Sequences

>3dtd-a3-m1-cK (length=145) [Search sequence]

SLTETYGLWSINCGIQEGKKVCFMHRQEVNDQNRVVVAMSVVLNADGVVSGNLTVPFGIL VSKPVRLQVDEGKAVIETGIRTCVPAGCIVPIVFDKNYVAALRAGKHLKLAMTIAAPGEP PLNDLFVQLNGFSNALNRLIALQKE

>3dtd-a3-m1-cL (length=145) [Search sequence]

SLTETYGLWSINCGIQEGKKVCFMHRQEVNDQNRVVVAMSVVLNADGVVSGNLTVPFGIL VSKPVRLQVDEGKAVIETGIRTCVPAGCIVPIVFDKNYVAALRAGKHLKLAMTIAAPGEP PLNDLFVQLNGFSNALNRLIALQKE

Structure information

PDB ID	3dtd (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of invasion associated protein b from bartonella henselae
Assembly ID	3
Resolution	2.35Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	42
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	K	L
UniProt accession	A0A0H3LVG3	A0A0H3LVG3
Species	38323 (Bartonella henselae)	38323 (Bartonella henselae)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3dtd-a3-m1-cK_3dtd-a3-m1-cL.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3dtd-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3dtd/1/1:A/2:D 3dtd/1/1:F/2:G 3dtd/1/1:I/1:H 3dtd/1/1:J/1:B 3dtd/1/1:K/1:L 3dtd/1/2:E/2:C 3dtd/2/1:F/4:G 3dtd/4/1:I/1:H 3dtd/5/5:A/1:D 3dtd/6/1:E/1:C 3dtd/7/1:J/1:B
Other dimers with similar sequences but different poses	3dtd/1/1:A/1:L 3dtd/1/1:A/1:B 3dtd/1/1:F/1:I 3dtd/1/1:F/1:J 3dtd/1/1:I/1:J 3dtd/1/1:K/1:H 3dtd/1/1:L/1:B 3dtd/1/2:D/2:C 3dtd/1/2:E/1:H 3dtd/1/2:E/1:K 3dtd/1/2:G/2:C 3dtd/1/2:G/2:D