3dwq/1/1:D/1:C

Sequences

>3dwq-a1-m1-cD (length=117) [Search sequence]

EWTGDARDGMFSGVVITQFHTGQIDNKPYFCIEGKQSAGSSISACSMKNSSVWGASFSTL YNQALYFYTTGQPVRIYYEPGVWTYPPFVKALTSNALVGLSTCTTSTECFGPDRKKN

>3dwq-a1-m1-cC (length=120) [Search sequence]

EWTGDARDGMFSGVVITQFHTGQIDNKPYFCIEGKQSAGSSISACSMKNSSVWGASFSTL YNQALYFYTTGQPVRIYYEPGVWTYPPFVKALTSNALVGLSTCTTSTECFGPDRKKNSLE

Structure information

PDB ID	3dwq (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the A-subunit of the AB5 toxin from E. coli with Neu5Gc-2,3Gal-1,3GlcNAc
Assembly ID	1
Resolution	2.1Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	77
Sequence identity between the two chains	1.0
PubMed citation	18971931

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	C
UniProt accession	Q3ZTX8	Q3ZTX8
Species	562 (Escherichia coli)	562 (Escherichia coli)
Function annotation	BioLiP:3dwqD	BioLiP:3dwqC

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3dwq-a1-m1-cD_3dwq-a1-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3dwq-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3dwa/1/1:A/1:C 3dwa/1/1:B/1:D 3dwa/1/1:D/1:C 3dwa/1/1:E/1:A 3dwa/1/1:E/1:B 3dwp/1/1:A/1:C 3dwp/1/1:A/1:E 3dwp/1/1:B/1:D 3dwp/1/1:D/1:C 3dwp/1/1:E/1:B 3dwq/1/1:A/1:C 3dwq/1/1:A/1:E 3dwq/1/1:B/1:D 3dwq/1/1:E/1:B 4bwg/1/1:B/1:D 4bwg/1/1:B/1:F 4bwg/1/1:E/1:C 4bwg/1/1:F/1:C 4bwg/2/1:H/1:L 4bwg/2/1:J/1:H 4bwg/2/1:J/1:K 4bwg/2/1:K/1:I 4bwg/2/1:L/1:I