3dwq/1/1:D/1:C

Sequences
>3dwq-a1-m1-cD (length=117) [Search sequence]
EWTGDARDGMFSGVVITQFHTGQIDNKPYFCIEGKQSAGSSISACSMKNSSVWGASFSTL
YNQALYFYTTGQPVRIYYEPGVWTYPPFVKALTSNALVGLSTCTTSTECFGPDRKKN
>3dwq-a1-m1-cC (length=120) [Search sequence]
EWTGDARDGMFSGVVITQFHTGQIDNKPYFCIEGKQSAGSSISACSMKNSSVWGASFSTL
YNQALYFYTTGQPVRIYYEPGVWTYPPFVKALTSNALVGLSTCTTSTECFGPDRKKNSLE
Structure information
PDB ID 3dwq (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the A-subunit of the AB5 toxin from E. coli with Neu5Gc-2,3Gal-1,3GlcNAc
Assembly ID 1
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 77
Sequence identity between the two chains 1.0
PubMed citation 18971931
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D C
UniProt accession Q3ZTX8 Q3ZTX8
Species 562 (Escherichia coli) 562 (Escherichia coli)
Function annotation BioLiP:3dwqD BioLiP:3dwqC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3dwq-a1-m1-cD_3dwq-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3dwq-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3dwa/1/1:A/1:C 3dwa/1/1:B/1:D 3dwa/1/1:D/1:C 3dwa/1/1:E/1:A 3dwa/1/1:E/1:B 3dwp/1/1:A/1:C 3dwp/1/1:A/1:E 3dwp/1/1:B/1:D 3dwp/1/1:D/1:C 3dwp/1/1:E/1:B 3dwq/1/1:A/1:C 3dwq/1/1:A/1:E 3dwq/1/1:B/1:D 3dwq/1/1:E/1:B 4bwg/1/1:B/1:D 4bwg/1/1:B/1:F 4bwg/1/1:E/1:C 4bwg/1/1:F/1:C 4bwg/2/1:H/1:L 4bwg/2/1:J/1:H 4bwg/2/1:J/1:K 4bwg/2/1:K/1:I 4bwg/2/1:L/1:I

[Back to Home]