3dxr/2/2:B/6:B

Sequences
>3dxr-a2-m2-cB (length=69) [Search sequence]
SQQKIQAAEAELDLVTDMFNKLVNNCYKKCINTSYSEGELNKNESSCLDRCVAKYFETNV
QVGENMQKM
>3dxr-a2-m6-cB (length=69) [Search sequence]
SQQKIQAAEAELDLVTDMFNKLVNNCYKKCINTSYSEGELNKNESSCLDRCVAKYFETNV
QVGENMQKM
Structure information
PDB ID 3dxr (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the yeast inter-membrane space chaperone assembly TIM9.10
Assembly ID 2
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 15
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 6
Chain ID B B
UniProt accession P87108 P87108
Species 4932 (Saccharomyces cerevisiae) 4932 (Saccharomyces cerevisiae)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3dxr-a2-m2-cB_3dxr-a2-m6-cB.pdb.gz
Full biological assembly
Download: 3dxr-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3dxr/2/1:B/4:B 3dxr/2/3:B/5:B

[Back to Home]