3e19/3/1:A/3:A

Sequences
>3e19-a3-m1-cA (length=74) [Search sequence]
LMVVPLSEMGPGDKGIVVNILGGHNARQKLVSMGLTPGATIQVLESMGPIIISVGGVRFA
IGKGLAGRVMVRKL
>3e19-a3-m3-cA (length=74) [Search sequence]
LMVVPLSEMGPGDKGIVVNILGGHNARQKLVSMGLTPGATIQVLESMGPIIISVGGVRFA
IGKGLAGRVMVRKL
Structure information
PDB ID 3e19 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Iron Uptake Regulatory Protein (FeoA) Solved by Sulfur SAD in a Monoclinic Space Group
Assembly ID 3
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 25
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID A A
UniProt accession D0VWU5 D0VWU5
Species 277988 (Thermococcus thioreducens) 277988 (Thermococcus thioreducens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3e19-a3-m1-cA_3e19-a3-m3-cA.pdb.gz
Full biological assembly
Download: 3e19-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3e19/4/1:A/1:B 3e19/1/1:A/1:B 3e19/1/1:D/2:C 3e19/1/2:A/2:B 3e19/1/2:D/1:C 3e19/2/1:A/1:B 3e19/2/3:A/3:B 3e19/3/1:D/2:C 3e19/3/3:D/4:C
  • 3e19/4/1:B/1:C 3e19/1/1:B/1:C 3e19/1/2:B/2:C 3e19/2/1:B/1:C 3e19/2/3:B/3:C 3e19/3/2:B/2:C 3e19/3/4:B/4:C
  • 3e19/4/1:D/1:B 3e19/1/1:D/1:B 3e19/1/2:D/2:B 3e19/2/1:D/1:B 3e19/2/3:D/3:B
  • [Back to Home]