3e2u/5/1:B/1:C

Sequences
>3e2u-a5-m1-cB (length=72) [Search sequence]
PLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGH
GIFVRQSQIQVF
>3e2u-a5-m1-cC (length=72) [Search sequence]
PLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGH
GIFVRQSQIQVF
Structure information
PDB ID 3e2u (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the zink-knuckle 2 domain of human CLIP-170 in complex with CAP-Gly domain of human dynactin-1 (p150-GLUED)
Assembly ID 5
Resolution 2.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 11
Sequence identity between the two chains 1.0
PubMed citation 17828277
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession Q14203 Q14203
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:3e2uB BioLiP:3e2uC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3e2u-a5-m1-cB_3e2u-a5-m1-cC.pdb.gz
Full biological assembly
Download: 3e2u-assembly5.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3e2u/5/1:A/1:D 3e2u/5/1:B/1:D
Other dimers with similar sequences but different poses
  • 2hkn/1/1:B/1:A 2hl3/1/1:B/1:A
  • [Back to Home]