3e56/1/1:A/2:A

Sequences
>3e56-a1-m1-cA (length=75) [Search sequence]
LEVGVYECEIHLKFRLIEEKSLLSDREQLLQVLLDALTEGSDDFLETLQASVKAQEVSEF
KASPQMRRQLMRLRN
>3e56-a1-m2-cA (length=75) [Search sequence]
LEVGVYECEIHLKFRLIEEKSLLSDREQLLQVLLDALTEGSDDFLETLQASVKAQEVSEF
KASPQMRRQLMRLRN
Structure information
PDB ID 3e56 (database links: RCSB PDB PDBe PDBj PDBsum)
Title The 2.0 Angstrom Resolution Crystal Structure of NpR1517, a Putative Heterocyst Differentiation Inhibitor from Nostoc punctiforme
Assembly ID 1
Resolution 2.01Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 148
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession B2IZS7 B2IZS7
Species 63737 (Nostoc punctiforme PCC 73102) 63737 (Nostoc punctiforme PCC 73102)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3e56-a1-m1-cA_3e56-a1-m2-cA.pdb.gz
Full biological assembly
Download: 3e56-assembly1.cif.gz

[Back to Home]