3e7h/1/1:B/2:B

Sequences
>3e7h-a1-m1-cB (length=101) [Search sequence]
AVNFEVKDQTLMMELVPERLRGETATFDIEADGKVYVEKGRRVTARHIRQLEKDGVNFIE
VPVEYIVGKVSAKDYVNEATGELIITANQEISLEALANLSQ
>3e7h-a1-m2-cB (length=101) [Search sequence]
AVNFEVKDQTLMMELVPERLRGETATFDIEADGKVYVEKGRRVTARHIRQLEKDGVNFIE
VPVEYIVGKVSAKDYVNEATGELIITANQEISLEALANLSQ
Structure information
PDB ID 3e7h (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structure of the beta subunit of the DNA-directed RNA polymerase from Vibrio cholerae O1 biovar eltor
Assembly ID 1
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 48
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B B
UniProt accession Q9KV30 Q9KV30
Species 666 (Vibrio cholerae) 666 (Vibrio cholerae)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3e7h-a1-m1-cB_3e7h-a1-m2-cB.pdb.gz
Full biological assembly
Download: 3e7h-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3e7h/1/2:B/2:A 3e7h/1/1:B/1:A
  • 3e7h/1/2:B/1:A 3e7h/1/1:B/2:A
  • [Back to Home]