3e7h/1/2:B/1:A

Sequences

>3e7h-a1-m2-cB (length=101) [Search sequence]

AVNFEVKDQTLMMELVPERLRGETATFDIEADGKVYVEKGRRVTARHIRQLEKDGVNFIE VPVEYIVGKVSAKDYVNEATGELIITANQEISLEALANLSQ

>3e7h-a1-m1-cA (length=102) [Search sequence]

AVNFEVKDQTLMMELVPERLRGETATFDIEADGKVYVEKGRRVTARHIRQLEKDGVNFIE VPVEYIVGKVSAKDYVNEATGELIITANQEISLEALANLSQA

Structure information

PDB ID	3e7h (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The crystal structure of the beta subunit of the DNA-directed RNA polymerase from Vibrio cholerae O1 biovar eltor
Assembly ID	1
Resolution	1.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	67
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	1
Chain ID	B	A
UniProt accession	Q9KV30	Q9KV30
Species	666 (Vibrio cholerae)	666 (Vibrio cholerae)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3e7h-a1-m2-cB_3e7h-a1-m1-cA.pdb.gz

Full biological assembly Download: 3e7h-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

3e7h/1/1:B/2:B 3e7h/1/1:A/2:A 3e7h/1/2:B/2:A 3e7h/1/1:B/1:A