3e7k/2/1:G/1:F

Sequences
>3e7k-a2-m1-cG (length=52) [Search sequence]
SRVTFERVEQMSIQIKEVGDRVNYIKRSLQSLDSQIGHLQDLSALTVDTLKT
>3e7k-a2-m1-cF (length=54) [Search sequence]
GSRVTFERVEQMSIQIKEVGDRVNYIKRSLQSLDSQIGHLQDLSALTVDTLKTL
Structure information
PDB ID 3e7k (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of an antiparallel coiled-coil tetramerization domain from TRPM7 channels
Assembly ID 2
Resolution 2.01Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 69
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID G F
UniProt accession Q925B3 Q925B3
Species 10116 (Rattus norvegicus) 10116 (Rattus norvegicus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3e7k-a2-m1-cG_3e7k-a2-m1-cF.pdb.gz
Full biological assembly
Download: 3e7k-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3e7k/1/1:C/1:B 3e7k/1/1:D/1:A 3e7k/2/1:E/1:H
Other dimers with similar sequences but different poses
  • 3e7k/1/1:C/1:D 3e7k/1/1:A/1:B 3e7k/2/1:F/1:E 3e7k/2/1:G/1:H
  • 3e7k/2/1:G/1:E 3e7k/1/1:C/1:A
  • [Back to Home]