3e8m/2/1:C/2:D

Sequences
>3e8m-a2-m1-cC (length=164) [Search sequence]
MKEIKLILTDIDGVWTDGGMFYDQTGNEWKKFNTSDSAGIFWAHNKGIPVGILTGEKTEI
VRRRAEKLKVDYLFQGVVDKLSAAEELCNELGINLEQVAYIGDDLNDAKLLKRVGIAGVP
ASAPFYIRRLSTIFLEKRGGEGVFREFVEKVLGINLEDFIAVIQ
>3e8m-a2-m2-cD (length=164) [Search sequence]
MKEIKLILTDIDGVWTDGGMFYDQTGNEWKKFNTSDSAGIFWAHNKGIPVGILTGEKTEI
VRRRAEKLKVDYLFQGVVDKLSAAEELCNELGINLEQVAYIGDDLNDAKLLKRVGIAGVP
ASAPFYIRRLSTIFLEKRGGEGVFREFVEKVLGINLEDFIAVIQ
Structure information
PDB ID 3e8m (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure-function Analysis of 2-Keto-3-deoxy-D-glycero-D-galacto-nononate-9-phosphate (KDN) Phosphatase Defines a New Clad Within the Type C0 HAD Subfamily
Assembly ID 2
Resolution 1.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 12
Sequence identity between the two chains 1.0
PubMed citation 18986982
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID C D
UniProt accession Q8A712 Q8A712
Species 818 (Bacteroides thetaiotaomicron) 818 (Bacteroides thetaiotaomicron)
Function annotation BioLiP:3e8mC BioLiP:3e8mD
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3e8m-a2-m1-cC_3e8m-a2-m2-cD.pdb.gz
Full biological assembly
Download: 3e8m-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3e81/2/1:A/2:B 3e81/2/1:B/2:A 3e81/2/1:C/2:D 3e81/2/1:D/2:C 3e84/2/1:A/2:B 3e84/2/1:B/2:A 3e84/2/1:C/2:D 3e84/2/1:D/2:C 3e8m/2/1:A/2:B 3e8m/2/1:B/2:A 3e8m/2/1:D/2:C
Other dimers with similar sequences but different poses
  • 3e8m/2/2:A/2:C 3e81/1/1:A/1:B 3e81/1/1:A/1:C 3e81/1/1:B/1:D 3e81/1/1:C/1:D 3e81/2/1:A/1:B 3e81/2/1:A/1:C 3e81/2/1:B/1:D 3e81/2/1:C/1:D 3e81/2/2:A/2:B 3e81/2/2:A/2:C 3e81/2/2:B/2:D 3e81/2/2:C/2:D 3e84/1/1:A/1:B 3e84/1/1:A/1:C 3e84/1/1:B/1:D 3e84/1/1:C/1:D 3e84/2/1:A/1:B 3e84/2/1:A/1:C 3e84/2/1:B/1:D 3e84/2/1:C/1:D 3e84/2/2:A/2:B 3e84/2/2:A/2:C 3e84/2/2:B/2:D 3e84/2/2:C/2:D 3e8m/1/1:A/1:B 3e8m/1/1:A/1:C 3e8m/1/1:B/1:D 3e8m/1/1:C/1:D 3e8m/2/1:A/1:B 3e8m/2/1:A/1:C 3e8m/2/1:B/1:D 3e8m/2/1:C/1:D 3e8m/2/2:A/2:B 3e8m/2/2:B/2:D 3e8m/2/2:C/2:D 4hgo/1/1:A/1:B 4hgo/1/1:A/1:C 4hgo/1/1:D/1:B 4hgo/1/1:D/1:C 4hgq/1/1:A/1:B 4hgq/1/1:A/1:C 4hgq/1/1:B/1:D 4hgq/1/1:C/1:D 4hgq/2/1:E/1:F 4hgq/2/1:E/1:G 4hgq/2/1:F/1:H 4hgq/2/1:G/1:H 4hgr/1/1:A/1:B 4hgr/1/1:B/1:D 4hgr/1/1:C/1:A 4hgr/1/1:C/1:D 4hgr/2/1:F/1:E 4hgr/2/1:F/1:H 4hgr/2/1:G/1:E 4hgr/2/1:H/1:G
  • 3e81/2/1:A/2:D 3e81/2/1:B/2:B 3e81/2/1:D/2:A 3e84/2/1:C/2:C
  • [Back to Home]