3efe/3/1:F/1:E

Sequences

>3efe-a3-m1-cF (length=207) [Search sequence]

TKKAFLYVFNTMSDWEYGYLIAELNSGRYFKKDLAPLKVITVGANKEMITTMGGLRIKPD
ISLDECTLESKDLLILPGGTTWSEEIHQPILERIGQALKIGTIVAAICGATDALANMGYL
DTRKHTSNNLEYTKMVCPNYKGEKFYELGPAVSDANLVTASGIAPLEFAMEVLKKIDVFT
LDALHSWYNLNKTHKPEYFFQLMNSIN

>3efe-a3-m1-cE (length=208) [Search sequence]

Structure information

PDB ID	3efe (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The crystal structure of the thiJ/pfpI family protein from Bacillus anthracis
Assembly ID	3
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	93
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	F	E
UniProt accession	A0A6H3AJL8	A0A6H3AJL8
Species	1392 (Bacillus anthracis)	1392 (Bacillus anthracis)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3efe-a3-m1-cF_3efe-a3-m1-cE.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3efe-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3efe/1/1:A/1:D 3efe/2/1:C/1:B