3efx/1/1:G/1:H

Sequences

>3efx-a1-m1-cG (length=95) [Search sequence]

APQNITELCSEYHNTQIYTINDKILSYTESLAGKREMAIITFKNGATFQVEVPQKKAIER MKDTLRIAYLTEAKVEKLCVWNNKTPNSIAAISMA

>3efx-a1-m1-cH (length=100) [Search sequence]

APQNITELCSEYHNTQIYTINDKILSYTESLAGKREMAIITFKNGATFQVEVPGHIDSQK KAIERMKDTLRIAYLTEAKVEKLCVWNNKTPNSIAAISMA

Structure information

PDB ID	3efx (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Novel binding site identified in a hybrid between cholera toxin and heat-labile enterotoxin, 1.9A crystal structure reveals the details
Assembly ID	1
Resolution	1.94Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	81
Sequence identity between the two chains	1.0
PubMed citation	15341730

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	G	H
UniProt accession	P01556	P01556
Species	243277 (Vibrio cholerae O1 biovar El Tor str. N16961)	243277 (Vibrio cholerae O1 biovar El Tor str. N16961)
Function annotation	BioLiP:3efxG	BioLiP:3efxH

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 3efx-a1-m1-cG_3efx-a1-m1-cH.pdb.gz

Full biological assembly Download: 3efx-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3efx/2/1:I/1:M 3efx/2/1:J/1:I 3efx/2/1:K/1:J 3efx/2/1:K/1:L