3eg1/1/1:B/1:A

Sequences
>3eg1-a1-m1-cB (length=56) [Search sequence]
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSQYITPV
>3eg1-a1-m1-cA (length=58) [Search sequence]
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSQYITPVNS
Structure information
PDB ID 3eg1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the N114Q mutant of ABL-SH3 domain complexed with a designed high-affinity peptide ligand: implications for SH3-ligand interactions
Assembly ID 1
Resolution 1.85Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 22
Sequence identity between the two chains 1.0
PubMed citation 19906645
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession P00519 P00519
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:3eg1B BioLiP:3eg1A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3eg1-a1-m1-cB_3eg1-a1-m1-cA.pdb.gz
Full biological assembly
Download: 3eg1-assembly1.cif.gz

[Back to Home]