3ej0/2/2:A/3:A

Sequences
>3ej0-a2-m2-cA (length=173) [Search sequence]
FSNVPAGKDLPQDFNVIIEIPAQSEPVKYEADKALGLLVVDRFIGTGMRYPVNYGFIPQT
LSGDGDPVDVLVITPFPLLAGSVVRARALGMLKMTDESGVDAKLVAVPHDKVCPMTANLK
SIDDVPAYLKDQIKHFFEQYKALEKGKWVKVEGWDGIDAAHKEITDGVANFKK
>3ej0-a2-m3-cA (length=173) [Search sequence]
FSNVPAGKDLPQDFNVIIEIPAQSEPVKYEADKALGLLVVDRFIGTGMRYPVNYGFIPQT
LSGDGDPVDVLVITPFPLLAGSVVRARALGMLKMTDESGVDAKLVAVPHDKVCPMTANLK
SIDDVPAYLKDQIKHFFEQYKALEKGKWVKVEGWDGIDAAHKEITDGVANFKK
Structure information
PDB ID 3ej0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of inorganic pyrophosphatase from burkholderia pseudomallei with bound N-(pyridin-3-ylmethyl) aniline, H32 crystal form
Assembly ID 2
Resolution 1.96Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 48
Sequence identity between the two chains 1.0
PubMed citation 19855826
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A A
UniProt accession Q3JUV5 Q3JUV5
Species 320372 (Burkholderia pseudomallei 1710b) 320372 (Burkholderia pseudomallei 1710b)
Function annotation BioLiP:3ej0A BioLiP:3ej0A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3ej0-a2-m2-cA_3ej0-a2-m3-cA.pdb.gz
Full biological assembly
Download: 3ej0-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3eiy/1/1:A/2:A 3eiy/1/1:A/3:A 3eiy/1/2:A/3:A 3eiy/1/4:A/5:A 3eiy/1/4:A/6:A 3eiy/1/5:A/6:A 3eiy/2/1:A/2:A 3eiy/2/1:A/3:A 3eiy/2/2:A/3:A 3eiz/1/1:A/2:A 3eiz/1/1:A/3:A 3eiz/1/2:A/3:A 3eiz/1/4:A/5:A 3eiz/1/4:A/6:A 3eiz/1/5:A/6:A 3eiz/2/1:A/2:A 3eiz/2/1:A/3:A 3eiz/2/2:A/3:A 3ej0/1/1:A/2:A 3ej0/1/1:A/3:A 3ej0/1/2:A/3:A 3ej0/1/4:A/5:A 3ej0/1/4:A/6:A 3ej0/1/5:A/6:A 3ej0/2/1:A/2:A 3ej0/2/1:A/3:A 3ej2/1/1:A/2:A 3ej2/1/1:A/3:A 3ej2/1/2:A/3:A 3ej2/1/4:A/5:A 3ej2/1/4:A/6:A 3ej2/1/5:A/6:A 3ej2/2/1:A/2:A 3ej2/2/1:A/3:A 3ej2/2/2:A/3:A 3gvf/1/1:A/2:A 3gvf/1/1:A/3:A 3gvf/1/2:A/3:A 3gvf/1/4:A/5:A 3gvf/1/4:A/6:A 3gvf/1/5:A/6:A 3gvf/2/1:A/2:A 3gvf/2/1:A/3:A 3gvf/2/2:A/3:A
Other dimers with similar sequences but different poses
  • 3d63/1/1:A/2:B 3d63/1/1:A/3:C 3d63/1/2:B/3:C
  • 3ej0/1/1:A/6:A 3eiy/1/1:A/5:A 3eiy/1/2:A/4:A 3eiy/1/3:A/6:A 3eiz/1/1:A/6:A 3eiz/1/2:A/5:A 3eiz/1/3:A/4:A 3ej0/1/2:A/5:A 3ej0/1/3:A/4:A 3ej2/1/1:A/4:A 3ej2/1/2:A/6:A 3ej2/1/3:A/5:A 3gvf/1/1:A/6:A 3gvf/1/2:A/5:A 3gvf/1/3:A/4:A
  • 3gvf/1/3:A/6:A 3eiz/1/1:A/4:A 3eiz/1/2:A/6:A 3eiz/1/3:A/5:A 3ej2/1/1:A/6:A 3ej2/1/2:A/5:A 3ej2/1/3:A/4:A 3gvf/1/1:A/5:A 3gvf/1/2:A/4:A
  • [Back to Home]