3enw/1/1:A/1:B

Sequences

>3enw-a1-m1-cA (length=217) [Search sequence]

TQDEMKKAAGWAALKYVEKGSIVGVGTGSTVNHFIDALGTMSEEIKGAVSSSVASTEKLE
ALGIKIFDCNEVASLDIYVDGADEINADREMIKGGGAALTREKIVAAIADKFICIVDGTK
AVDVLGTFPLPVEVIPMARSYVARQLVKLGGDPCYREGVITDNGNVILDVYGMKITNPKQ
LEDQINAIPGVVTVGLFAHRGADVVITGTPEGAKIEE

>3enw-a1-m1-cB (length=217) [Search sequence]

Structure information

PDB ID	3enw (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Substrate and inhibitor complexes of ribose 5-phosphate isomerase from Vibrio vulnificus YJ016
Assembly ID	1
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	84
Sequence identity between the two chains	1.0
PubMed citation	19214439

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q7MHL9	Q7MHL9
Species	672 (Vibrio vulnificus)	672 (Vibrio vulnificus)
Function annotation	BioLiP:3enwA	BioLiP:3enwB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3enw-a1-m1-cA_3enw-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3enw-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3enq/1/1:A/1:B 3env/1/1:A/1:B