3epy/1/2:B/1:A

Sequences
>3epy-a1-m2-cB (length=86) [Search sequence]
LQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNL
KKGLSTEDATSAYISKAKELIEKYGI
>3epy-a1-m1-cA (length=88) [Search sequence]
MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAW
NLKKGLSTEDATSAYISKAKELIEKYGI
Structure information
PDB ID 3epy (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of human acyl-CoA binding domain 7 complexed with palmitoyl-Coa
Assembly ID 1
Resolution 2.005Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 22
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 2 1
Chain ID B A
UniProt accession Q8N6N7 Q8N6N7
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:3epyB BioLiP:3epyA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3epy-a1-m2-cB_3epy-a1-m1-cA.pdb.gz
Full biological assembly
Download: 3epy-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3epy/1/1:B/2:B 3epy/1/1:A/2:A
  • 3epy/2/1:B/1:A 3epy/1/1:B/1:A 3epy/1/2:B/2:A
  • [Back to Home]