3epy/2/1:B/1:A

Sequences

>3epy-a2-m1-cB (length=86) [Search sequence]

LQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNL KKGLSTEDATSAYISKAKELIEKYGI

>3epy-a2-m1-cA (length=88) [Search sequence]

MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAW NLKKGLSTEDATSAYISKAKELIEKYGI

Structure information

PDB ID	3epy (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of human acyl-CoA binding domain 7 complexed with palmitoyl-Coa
Assembly ID	2
Resolution	2.005Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	183
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q8N6N7	Q8N6N7
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:3epyB	BioLiP:3epyA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3epy-a2-m1-cB_3epy-a2-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3epy-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3epy/1/1:B/1:A 3epy/1/2:B/2:A
Other dimers with similar sequences but different poses	3epy/1/1:B/2:B 3epy/1/1:A/2:A 3epy/1/2:B/1:A 3epy/1/1:B/2:A