3erm/2/1:C/2:C

Sequences
>3erm-a2-m1-cC (length=62) [Search sequence]
DRKLADAHDQLELAELLTDVLIKNVPGLSEKHAEDASIYAKNRAVFAAAFKNNATALSEL
SE
>3erm-a2-m2-cC (length=62) [Search sequence]
DRKLADAHDQLELAELLTDVLIKNVPGLSEKHAEDASIYAKNRAVFAAAFKNNATALSEL
SE
Structure information
PDB ID 3erm (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structure of a conserved protein with unknown function from Pseudomonas syringae pv. tomato str. DC3000
Assembly ID 2
Resolution 2.45Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 78
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID C C
UniProt accession Q887T9 Q887T9
Species 323 (Pseudomonas syringae pv. tomato) 323 (Pseudomonas syringae pv. tomato)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3erm-a2-m1-cC_3erm-a2-m2-cC.pdb.gz
Full biological assembly
Download: 3erm-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3erm/1/1:B/1:A 3erm/3/1:D/2:D 3erm/4/1:E/3:E

[Back to Home]