3esh/2/1:C/1:A

Sequences

>3esh-a2-m1-cC (length=266) [Search sequence]

KIGDISIHYLNGGNTKDGGAFGVVPKPLWSKQYNANERNQINLPTHPILIQTAQYNLIID
AGIGNGKLSEKQLRNFGVDEESHIIADLANYNLTPKDIDYVLTHHFDHAAGLTDQAGHAI
FENAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNKLILFEKHFEPVPGIKQHSGGHS
FGHTIITIESQGDKAVHGDIFPTTAHKNPLWVTAYDDYPQSIREKERIPYFIQQQYWFLF
YHDENYFAVKYSDDGENIDAYILRET

>3esh-a2-m1-cA (length=268) [Search sequence]

Structure information

PDB ID	3esh (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of a probable metal-dependent hydrolase from Staphylococcus aureus. Northeast Structural Genomics target ZR314
Assembly ID	2
Resolution	2.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	72
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	A
UniProt accession	A0A0H3JZW1	A0A0H3JZW1
Species	158878 (Staphylococcus aureus subsp. aureus Mu50)	158878 (Staphylococcus aureus subsp. aureus Mu50)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3esh-a2-m1-cC_3esh-a2-m1-cA.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3esh-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	3esh/1/1:B/2:B 3esh/1/1:C/1:A 3esh/1/2:C/2:A
Other dimers with similar sequences but different poses	3esh/1/1:B/2:C 3esh/1/1:B/1:A 3esh/1/1:C/2:A 3esh/1/1:C/2:B 3esh/1/2:B/2:A 3esh/1/2:C/1:A 3esh/2/1:B/1:A