3exw/1/1:A/1:C

Sequences

>3exw-a1-m1-cA (length=198) [Search sequence]

DDNINTLWTGVNPTTANCQIMASSESNDCKLILTLVKTGALVTAFVYVIGVSNDFNMLTT
HKNINFTAELFFDSTGNLLTSLSSLKTPLNHKSGQNMATGALTNAKGFMPSTTAYPFNVN
SREKENYIYGTCYYTASDHTAFPIDISVMLNQRALNNETSYCIRVTWSWNTGVAPEVQTS
ATTLVTSPFTFYYIREDD

>3exw-a1-m1-cC (length=198) [Search sequence]

Structure information

PDB ID	3exw (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the human Adenovirus type 7 fiber knob
Assembly ID	1
Resolution	1.75Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	62
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	C
UniProt accession	P15141	P15141
Species	10519 (Human adenovirus 7)	10519 (Human adenovirus 7)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3exw-a1-m1-cA_3exw-a1-m1-cC.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3exw-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2o39/1/1:A/2:A 2o39/1/1:A/3:A 2o39/1/2:A/3:A 2o39/2/1:B/4:B 2o39/2/1:B/5:B 2o39/2/4:B/5:B 3exv/1/1:A/2:A 3exv/1/1:A/3:A 3exv/1/2:A/3:A 3exw/1/1:A/1:B 3exw/1/1:B/1:C 3f0y/1/1:A/1:B 3f0y/1/1:A/1:C 3f0y/1/1:B/1:C 3f0y/2/1:D/1:E 3f0y/2/1:D/1:F 3f0y/2/1:E/1:F 3f0y/3/1:H/1:G 3f0y/3/1:H/1:I 3f0y/3/1:I/1:G 3o8e/1/1:A/2:A 3o8e/1/1:A/3:A 3o8e/1/2:A/3:A 3o8e/2/1:C/4:C 3o8e/2/1:C/5:C 3o8e/2/4:C/5:C 4zdg/1/1:A/1:B 4zdg/1/1:A/1:C 4zdg/1/1:B/1:C 7agf/1/1:A/1:B 7agf/1/1:A/1:C 7agf/1/1:B/1:C 7agg/1/1:A/1:B 7agg/1/1:A/1:C 7agg/1/1:B/1:C