3ezj/4/1:D/1:H

Sequences
>3ezj-a4-m1-cD (length=120) [Search sequence]
QVQLQESGGGLVQAGGSLRLSCAASGSIFSINSMDWDRQAPGKQRELVATITSGGSTNYA
DSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNANVKTWAGMTRDYWGQGTQVTVSS
>3ezj-a4-m1-cH (length=120) [Search sequence]
QVQLQESGGGLVQAGGSLRLSCAASGSIFSINSMDWDRQAPGKQRELVATITSGGSTNYA
DSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNANVKTWAGMTRDYWGQGTQVTVSS
Structure information
PDB ID 3ezj (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the N-terminal domain of the secretin GspD from ETEC determined with the assistance of a nanobody
Assembly ID 4
Resolution 2.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 28
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D H
UniProt accession
Species 9844 (Lama glama) 9844 (Lama glama)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3ezj-a4-m1-cD_3ezj-a4-m1-cH.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3ezj-assembly4.cif.gz
Similar dimers

[Back to Home]