3f3r/3/1:B/1:A

Sequences

>3f3r-a3-m1-cB (length=104) [Search sequence]

HMVTQFKTASEFDSAIAQDKLVVVDFYATWCGPSKMIAPMIEKFSEQYPQADFYKLDVDE LGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAANA

>3f3r-a3-m1-cA (length=106) [Search sequence]

HHHMVTQFKTASEFDSAIAQDKLVVVDFYATWCGPSKMIAPMIEKFSEQYPQADFYKLDV DELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAANA

Structure information

PDB ID	3f3r (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of yeast Thioredoxin1-glutathione mixed disulfide complex
Assembly ID	3
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	64
Sequence identity between the two chains	1.0
PubMed citation	19362171

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	P22217	P22217
Species	4932 (Saccharomyces cerevisiae)	4932 (Saccharomyces cerevisiae)
Function annotation	BioLiP:3f3rB	BioLiP:3f3rA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3f3r-a3-m1-cB_3f3r-a3-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3f3r-assembly3.cif.gz