3f3r/3/1:B/1:A

Sequences
>3f3r-a3-m1-cB (length=104) [Search sequence]
HMVTQFKTASEFDSAIAQDKLVVVDFYATWCGPSKMIAPMIEKFSEQYPQADFYKLDVDE
LGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAANA
>3f3r-a3-m1-cA (length=106) [Search sequence]
HHHMVTQFKTASEFDSAIAQDKLVVVDFYATWCGPSKMIAPMIEKFSEQYPQADFYKLDV
DELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAANA
Structure information
PDB ID 3f3r (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of yeast Thioredoxin1-glutathione mixed disulfide complex
Assembly ID 3
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 64
Sequence identity between the two chains 1.0
PubMed citation 19362171
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession P22217 P22217
Species 4932 (Saccharomyces cerevisiae) 4932 (Saccharomyces cerevisiae)
Function annotation BioLiP:3f3rB BioLiP:3f3rA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3f3r-a3-m1-cB_3f3r-a3-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 3f3r-assembly3.cif.gz

[Back to Home]