3f5h/1/1:A/1:B

Sequences
>3f5h-a1-m1-cA (length=54) [Search sequence]
SIDDLDAEALIRMALGPRNTMTSSNEQLVDALRASLKENEELRKESRRRADRRQ
>3f5h-a1-m1-cB (length=57) [Search sequence]
SIDDLDAEALIRMALGPRNTMTSSNEQLVDALRASLKENEELRKESRRRADRRQEPM
Structure information
PDB ID 3f5h (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of fused docking domains from PikAIII and PikAIV of the pikromycin polyketide synthase
Assembly ID 1
Resolution 1.75Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 49
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q9ZGI2 Q9ZGI2
Species 54571 (Streptomyces venezuelae) 54571 (Streptomyces venezuelae)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3f5h-a1-m1-cA_3f5h-a1-m1-cB.pdb.gz
Full biological assembly
Download: 3f5h-assembly1.cif.gz

[Back to Home]