3f6w/5/1:C/1:D

Sequences
>3f6w-a5-m1-cC (length=80) [Search sequence]
NATKTIHNARYQALLDLLLEARSAAGITQKELAARLGRPQSFVSKTENAERRLDVIEFDF
CRGIGTDPYALLSKLEATPS
>3f6w-a5-m1-cD (length=80) [Search sequence]
SNATKTIHNARYQALLDLLLEARSAAGITQKELAARLGRPQSFVSKTENAERRLDVIEFD
FCRGIGTDPYALLSKLEATP
Structure information
PDB ID 3f6w (database links: RCSB PDB PDBe PDBj PDBsum)
Title XRE-family like protein from Pseudomonas syringae pv. tomato str. DC3000
Assembly ID 5
Resolution 1.85Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 46
Sequence identity between the two chains 0.988
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession Q889N2 Q889N2
Species 223283 (Pseudomonas syringae pv. tomato str. DC3000) 223283 (Pseudomonas syringae pv. tomato str. DC3000)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3f6w-a5-m1-cC_3f6w-a5-m1-cD.pdb.gz
Full biological assembly
Download: 3f6w-assembly5.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3f6w/2/1:A/1:B 3f6w/6/1:E/4:E
Other dimers with similar sequences but different poses
  • 3f6w/3/1:B/3:D 3f6w/1/1:A/2:A 3f6w/4/1:E/1:C
  • [Back to Home]