3fd9/1/1:C/1:A

Sequences

>3fd9-a1-m1-cC (length=236) [Search sequence]

ASSSLYRESGIISARQLALLQRLPRLRLEQLFRCEWLQQRLARGLALGREEVRQILLCAA
QDDDGWCAELGDRVNLAVPQSIDWVLLPVYGWWESLLDQAIPGWRLSLVELETQSRQLRI
KSEFWSRVAELEPEQAREELARVAKCQARTQEQVAELAGKLETASALAKSAWPNWQRGAT
LLASGGLAGFEPIPEVLECLWQPLCRLDDDVGAADAVQAWLHERNLCQAQDHFYWQ

>3fd9-a1-m1-cA (length=237) [Search sequence]

Structure information

PDB ID	3fd9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of the transcriptional anti-activator ExsD from Pseudomonas aeruginosa
Assembly ID	1
Resolution	2.6Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	58
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	A
UniProt accession	A0A0H2Z989	A0A0H2Z989
Species	208963 (Pseudomonas aeruginosa UCBPP-PA14)	208963 (Pseudomonas aeruginosa UCBPP-PA14)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3fd9-a1-m1-cC_3fd9-a1-m1-cA.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3fd9-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3fd9/1/1:B/1:A 3fd9/1/1:B/1:C