3fdo/4/1:A/2:A

Sequences
>3fdo-a4-m1-cA (length=90) [Search sequence]
IQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLL
GELLGRQSFSVKDPSPLYDMLRKNLVTLAT
>3fdo-a4-m2-cA (length=90) [Search sequence]
IQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLL
GELLGRQSFSVKDPSPLYDMLRKNLVTLAT
Structure information
PDB ID 3fdo (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of human MDMX in complex with high affinity peptide
Assembly ID 4
Resolution 1.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 46
Sequence identity between the two chains 1.0
PubMed citation 19305137
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession O15151 O15151
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:3fdoA BioLiP:3fdoA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3fdo-a4-m1-cA_3fdo-a4-m2-cA.pdb.gz
Full biological assembly
Download: 3fdo-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2vyr/1/1:A/1:D 2vyr/1/1:B/1:C
  • 3u15/2/1:D/1:C 3u15/1/1:A/1:B
  • [Back to Home]