3ff5/1/1:A/1:B

Sequences
>3ff5-a1-m1-cA (length=54) [Search sequence]
GPLGSPEFREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTDEEIDLAFQQS
>3ff5-a1-m1-cB (length=54) [Search sequence]
GPLGSPEFREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTDEEIDLAFQQS
Structure information
PDB ID 3ff5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the conserved N-terminal domain of the peroxisomal matrix-protein-import receptor, Pex14p
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 32
Sequence identity between the two chains 1.0
PubMed citation 19122147
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q642G4 Q642G4
Species 10116 (Rattus norvegicus) 10116 (Rattus norvegicus)
Function annotation BioLiP:3ff5A BioLiP:3ff5B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3ff5-a1-m1-cA_3ff5-a1-m1-cB.pdb.gz
Full biological assembly
Download: 3ff5-assembly1.cif.gz

[Back to Home]