3fn2/1/2:B/3:B

Sequences
>3fn2-a1-m2-cB (length=94) [Search sequence]
YTQRDNQKTLAVYFEEINRDVEYLSGRLSEKELKDKYRYYGRGYVRITDKDGQVITYEDG
SVQDKTVFLTNEGANKLGWKLEFLIDEKFEEEIL
>3fn2-a1-m3-cB (length=94) [Search sequence]
YTQRDNQKTLAVYFEEINRDVEYLSGRLSEKELKDKYRYYGRGYVRITDKDGQVITYEDG
SVQDKTVFLTNEGANKLGWKLEFLIDEKFEEEIL
Structure information
PDB ID 3fn2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a putative sensor histidine kinase domain from Clostridium symbiosum ATCC 14940
Assembly ID 1
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 12
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID B B
UniProt accession
Species 411472 ([Clostridium] symbiosum ATCC 14940) 411472 ([Clostridium] symbiosum ATCC 14940)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3fn2-a1-m2-cB_3fn2-a1-m3-cB.pdb.gz
Full biological assembly
Download: 3fn2-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3fn2/1/1:B/2:B 3fn2/1/1:B/3:B
Other dimers with similar sequences but different poses
  • 3fn2/1/3:A/3:B 3fn2/1/1:A/1:B 3fn2/1/2:A/2:B
  • [Back to Home]