3fnj/1/1:A/1:B

Sequences

>3fnj-a1-m1-cA (length=116) [Search sequence]

NDKKIELLTTYLSLYIDHHTVLADQNATGKYVVLDVRNAPAQVKKDQIKGAIAPAKDLAT RIGELDPAKTYVVYDWTGGTTLGKTALLVLLSAGFEAYELAGALEGWKGQLPVETL

>3fnj-a1-m1-cB (length=117) [Search sequence]

NDKKIELLTTYLSLYIDHHTVLADQNATGKYVVLDVRNAPAQVKKDQIKGAIAPAKDLAT RIGELDPAKTYVVYDWTGGTTLGKTALLVLLSAGFEAYELAGALEGWKGQLPVETLA

Structure information

PDB ID	3fnj (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the full-length lp_1913 protein from Lactobacillus plantarum, Northeast Structural Genomics Consortium Target LpR140
Assembly ID	1
Resolution	2.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	46
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	F9UPN6	F9UPN6
Species	1590 (Lactiplantibacillus plantarum)	1590 (Lactiplantibacillus plantarum)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3fnj-a1-m1-cA_3fnj-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3fnj-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3flh/1/1:A/1:B 3flh/1/1:C/1:A 3flh/1/1:C/1:B 3fnj/1/1:A/1:C 3fnj/1/1:C/1:B 3fnj/2/1:E/1:D 3fnj/2/1:E/1:F 3fnj/2/1:F/1:D