3ft7/1/1:A/1:B

Sequences
>3ft7-a1-m1-cA (length=45) [Search sequence]
LNGIKLGVYIPQEWHDRLMEIAKEKNLTLSDVCRLAIKEYLDNHD
>3ft7-a1-m1-cB (length=46) [Search sequence]
LLNGIKLGVYIPQEWHDRLMEIAKEKNLTLSDVCRLAIKEYLDNHD
Structure information
PDB ID 3ft7 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of an extremely stable dimeric protein from sulfolobus islandicus
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 113
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q54323 Q54323
Species 43080 (Sulfolobus islandicus) 43080 (Sulfolobus islandicus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3ft7-a1-m1-cA_3ft7-a1-m1-cB.pdb.gz
Full biological assembly
Download: 3ft7-assembly1.cif.gz
Similar dimers

[Back to Home]