3fxt/5/1:C/3:F

Sequences
>3fxt-a5-m1-cC (length=90) [Search sequence]
QSMDLQGELDRFGGISVRLARLDALDRLDAAAFQKGLQAAVQQWRSEGRTAVWLHIPILQ
SRFIAPAASLGFCFHHAESDSSTLTLWLRE
>3fxt-a5-m3-cF (length=90) [Search sequence]
QSMDLQGELDRFGGISVRLARLDALDRLDAAAFQKGLQAAVQQWRSEGRTAVWLHIPILQ
SRFIAPAASLGFCFHHAESDSSTLTLWLRE
Structure information
PDB ID 3fxt (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the N-terminal domain of human NUDT6
Assembly ID 5
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 59
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID C F
UniProt accession P53370 P53370
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3fxt-a5-m1-cC_3fxt-a5-m3-cF.pdb.gz
Full biological assembly
Download: 3fxt-assembly5.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3fxt/1/1:E/1:A 3fxt/2/1:G/1:B 3fxt/3/1:F/2:C 3fxt/4/1:H/1:D

[Back to Home]