3g1b/1/1:A/1:B

Sequences

>3g1b-a1-m1-cA (length=80) [Search sequence]

LYRVLILNDDYTPAEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVAETKVA QVIDSARRHQHPLQCTMEKD

>3g1b-a1-m1-cB (length=81) [Search sequence]

SLYRVLILNDDYTPAEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVAETKV AQVIDSARRHQHPLQCTMEKD

Structure information

PDB ID	3g1b (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The structure of the M53A mutant of Caulobacter crescentus clpS protease adaptor protein in complex with WLFVQRDSKE peptide
Assembly ID	1
Resolution	1.448Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	23
Sequence identity between the two chains	1.0
PubMed citation	19451643

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q9A5I0	Q9A5I0
Species	155892 (Caulobacter vibrioides)	155892 (Caulobacter vibrioides)
Function annotation	BioLiP:3g1bA	BioLiP:3g1bB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 3g1b-a1-m1-cA_3g1b-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 3g1b-assembly1.cif.gz

Similar dimers