3g27/1/1:A/2:A

Sequences
>3g27-a1-m1-cA (length=80) [Search sequence]
RKAARGRECQVRIPGVCNGNPETSVLAHIRKPPDLIATIACSACHDEIDRRTHFVDAGYA
KECALEGARTQVIWLKEGVI
>3g27-a1-m2-cA (length=80) [Search sequence]
RKAARGRECQVRIPGVCNGNPETSVLAHIRKPPDLIATIACSACHDEIDRRTHFVDAGYA
KECALEGARTQVIWLKEGVI
Structure information
PDB ID 3g27 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of a putative bacteriophage protein from Escherichia coli str. K-12 substr. MG1655
Assembly ID 1
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 32
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P68661 P68661
Species 83333 (Escherichia coli K-12) 83333 (Escherichia coli K-12)
Function annotation BioLiP:3g27A BioLiP:3g27A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3g27-a1-m1-cA_3g27-a1-m2-cA.pdb.gz
Full biological assembly
Download: 3g27-assembly1.cif.gz

[Back to Home]