3g4x/1/1:A/2:A

Sequences
>3g4x-a1-m1-cA (length=117) [Search sequence]
HCDLPCGVFDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQRAELAKHHVSVLWS
DYFKPPHFEKYPELHQLVNDTLKALSAAKGSKDPATGQKALDYIAQIDKIFWETKKA
>3g4x-a1-m2-cA (length=117) [Search sequence]
HCDLPCGVFDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQRAELAKHHVSVLWS
DYFKPPHFEKYPELHQLVNDTLKALSAAKGSKDPATGQKALDYIAQIDKIFWETKKA
Structure information
PDB ID 3g4x (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of NiSOD Y9F mutant
Assembly ID 1
Resolution 2.01Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 58
Sequence identity between the two chains 1.0
PubMed citation 19183068
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P80735 P80735
Species 1902 (Streptomyces coelicolor) 1902 (Streptomyces coelicolor)
Function annotation BioLiP:3g4xA BioLiP:3g4xA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3g4x-a1-m1-cA_3g4x-a1-m2-cA.pdb.gz
Full biological assembly
Download: 3g4x-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1t6i/1/1:A/2:A 1t6i/1/1:C/2:B 1t6i/1/2:C/1:B 1t6q/1/1:A/2:C 1t6q/1/1:B/2:B 1t6q/1/1:C/2:A 1t6u/1/1:D/1:A 1t6u/1/1:E/1:C 1t6u/1/1:F/1:B 1t6u/2/1:G/1:J 1t6u/2/1:H/1:L 1t6u/2/1:K/1:I 3g4x/1/1:C/2:B 3g4x/1/2:C/1:B 3g4z/1/1:A/2:A 3g4z/1/1:B/2:C 3g4z/1/1:C/2:B 3g50/1/1:A/2:A 3g50/1/1:B/2:C 3g50/1/2:B/1:C 4ncq/1/1:A/2:A 4ncq/1/1:B/2:C 4ncq/1/1:C/2:B
Other dimers with similar sequences but different poses
  • 3g4z/1/2:A/2:C 1t6i/1/1:B/1:A 1t6i/1/1:C/1:A 1t6i/1/1:C/1:B 1t6i/1/2:B/2:A 1t6i/1/2:C/2:A 1t6i/1/2:C/2:B 1t6q/1/1:A/1:B 1t6q/1/1:A/1:C 1t6q/1/1:C/1:B 1t6q/1/2:A/2:B 1t6q/1/2:A/2:C 1t6q/1/2:C/2:B 1t6u/1/1:A/1:B 1t6u/1/1:A/1:C 1t6u/1/1:B/1:C 1t6u/1/1:D/1:E 1t6u/1/1:F/1:D 1t6u/1/1:F/1:E 1t6u/2/1:G/1:I 1t6u/2/1:H/1:G 1t6u/2/1:H/1:I 1t6u/2/1:K/1:J 1t6u/2/1:K/1:L 1t6u/2/1:L/1:J 3g4x/1/1:A/1:B 3g4x/1/1:C/1:A 3g4x/1/1:C/1:B 3g4x/1/2:A/2:B 3g4x/1/2:C/2:A 3g4x/1/2:C/2:B 3g4z/1/1:A/1:B 3g4z/1/1:A/1:C 3g4z/1/1:B/1:C 3g4z/1/2:A/2:B 3g4z/1/2:B/2:C 3g50/1/1:B/1:A 3g50/1/1:B/1:C 3g50/1/1:C/1:A 3g50/1/2:B/2:A 3g50/1/2:B/2:C 3g50/1/2:C/2:A 4ncq/1/1:B/1:A 4ncq/1/1:B/1:C 4ncq/1/1:C/1:A 4ncq/1/2:B/2:A 4ncq/1/2:B/2:C 4ncq/1/2:C/2:A
  • 3g4z/1/1:B/2:B 1t6i/1/1:B/2:B 1t6i/1/1:C/2:A 1t6i/1/2:C/1:A 1t6q/1/1:A/2:B 1t6q/1/1:C/2:C 1t6q/1/2:A/1:B 1t6u/1/1:D/1:C 1t6u/1/1:E/1:B 1t6u/1/1:F/1:A 1t6u/2/1:H/1:K 1t6u/2/1:I/1:J 1t6u/2/1:L/1:G 3g4x/1/1:B/2:B 3g4x/1/1:C/2:A 3g4x/1/2:C/1:A 3g4z/1/1:A/2:C 3g4z/1/1:C/2:A 3g50/1/1:B/2:B 3g50/1/1:C/2:A 3g50/1/2:C/1:A 4ncq/1/1:B/2:B 4ncq/1/1:C/2:A 4ncq/1/2:C/1:A
  • [Back to Home]