3g4z/1/2:A/2:C |
| >3g4z-a1-m2-cA (length=117) [Search sequence] |
HCDLPCGVFDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQRAELAKHHVSVLWS DYFKPPHFEKYPELHQLVNDTLKALSAAKGSKDPATGQKALDYIAQIDKIFWETKKA |
| >3g4z-a1-m2-cC (length=117) [Search sequence] |
HCDLPCGVFDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQRAELAKHHVSVLWS DYFKPPHFEKYPELHQLVNDTLKALSAAKGSKDPATGQKALDYIAQIDKIFWETKKA |
|
| PDB ID |
3g4z (database links:
RCSB PDB
PDBe
PDBj
PDBsum) |
| Title |
Crystal Structure of NiSOD Y9F mutant at 1.9 A |
| Assembly ID |
1 |
| Resolution |
1.87Å |
| Method of structure determination |
X-RAY DIFFRACTION |
| Number of inter-chain contacts |
19 |
| Sequence identity between the two chains |
1.0 |
| PubMed citation |
19183068 |
|
|
Chain 1 |
Chain 2 |
| Model ID |
2 |
2 |
| Chain ID |
A |
C |
| UniProt accession |
P80735 |
P80735 |
| Species |
1902 (Streptomyces coelicolor) |
1902 (Streptomyces coelicolor) |
| Function annotation |
BioLiP:3g4zA |
BioLiP:3g4zC |
|
Switch viewer: [NGL] [JSmol]
|
Dimer structure:
Chain 1 in red;
Chain 2 in blue.
|
Full biological assembly
|
|
| Other dimers with similar sequences and structures |
1t6i/1/1:B/1:A 1t6i/1/1:C/1:A 1t6i/1/1:C/1:B 1t6i/1/2:B/2:A 1t6i/1/2:C/2:A 1t6i/1/2:C/2:B 1t6q/1/1:A/1:B 1t6q/1/1:A/1:C 1t6q/1/1:C/1:B 1t6q/1/2:A/2:B 1t6q/1/2:A/2:C 1t6q/1/2:C/2:B 1t6u/1/1:A/1:B 1t6u/1/1:A/1:C 1t6u/1/1:B/1:C 1t6u/1/1:D/1:E 1t6u/1/1:F/1:D 1t6u/1/1:F/1:E 1t6u/2/1:G/1:I 1t6u/2/1:H/1:G 1t6u/2/1:H/1:I 1t6u/2/1:K/1:J 1t6u/2/1:K/1:L 1t6u/2/1:L/1:J 3g4x/1/1:A/1:B 3g4x/1/1:C/1:A 3g4x/1/1:C/1:B 3g4x/1/2:A/2:B 3g4x/1/2:C/2:A 3g4x/1/2:C/2:B 3g4z/1/1:A/1:B 3g4z/1/1:A/1:C 3g4z/1/1:B/1:C 3g4z/1/2:A/2:B 3g4z/1/2:B/2:C 3g50/1/1:B/1:A 3g50/1/1:B/1:C 3g50/1/1:C/1:A 3g50/1/2:B/2:A 3g50/1/2:B/2:C 3g50/1/2:C/2:A 4ncq/1/1:B/1:A 4ncq/1/1:B/1:C 4ncq/1/1:C/1:A 4ncq/1/2:B/2:A 4ncq/1/2:B/2:C 4ncq/1/2:C/2:A |
| Other dimers with similar sequences but different poses |
3g4x/1/1:A/2:A 1t6i/1/1:A/2:A 1t6i/1/1:C/2:B 1t6i/1/2:C/1:B 1t6q/1/1:A/2:C 1t6q/1/1:B/2:B 1t6q/1/1:C/2:A 1t6u/1/1:D/1:A 1t6u/1/1:E/1:C 1t6u/1/1:F/1:B 1t6u/2/1:G/1:J 1t6u/2/1:H/1:L 1t6u/2/1:K/1:I 3g4x/1/1:C/2:B 3g4x/1/2:C/1:B 3g4z/1/1:A/2:A 3g4z/1/1:B/2:C 3g4z/1/1:C/2:B 3g50/1/1:A/2:A 3g50/1/1:B/2:C 3g50/1/2:B/1:C 4ncq/1/1:A/2:A 4ncq/1/1:B/2:C 4ncq/1/1:C/2:B
3g4z/1/1:B/2:B 1t6i/1/1:B/2:B 1t6i/1/1:C/2:A 1t6i/1/2:C/1:A 1t6q/1/1:A/2:B 1t6q/1/1:C/2:C 1t6q/1/2:A/1:B 1t6u/1/1:D/1:C 1t6u/1/1:E/1:B 1t6u/1/1:F/1:A 1t6u/2/1:H/1:K 1t6u/2/1:I/1:J 1t6u/2/1:L/1:G 3g4x/1/1:B/2:B 3g4x/1/1:C/2:A 3g4x/1/2:C/1:A 3g4z/1/1:A/2:C 3g4z/1/1:C/2:A 3g50/1/1:B/2:B 3g50/1/1:C/2:A 3g50/1/2:C/1:A 4ncq/1/1:B/2:B 4ncq/1/1:C/2:A 4ncq/1/2:C/1:A |
|