3gaj/1/2:A/3:A

Sequences
>3gaj-a1-m2-cA (length=180) [Search sequence]
KIYTKNGDKGQTRIIGKQILYKNDPRVAAYGEVDELNSWVGYTKSLINSHTQVLSNELEE
IQQLLFDCGHDLATPADDERHSFKFKQEQPTVWLEEKIDNYTQVVPAVKKFILPGGTQLA
SALHVARTITRRAERQIVQLMREEQINQDVLIFINRLSDYFFAAARYANYLEQQPDMLYR
>3gaj-a1-m3-cA (length=180) [Search sequence]
KIYTKNGDKGQTRIIGKQILYKNDPRVAAYGEVDELNSWVGYTKSLINSHTQVLSNELEE
IQQLLFDCGHDLATPADDERHSFKFKQEQPTVWLEEKIDNYTQVVPAVKKFILPGGTQLA
SALHVARTITRRAERQIVQLMREEQINQDVLIFINRLSDYFFAAARYANYLEQQPDMLYR
Structure information
PDB ID 3gaj (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of a C-terminal deletion variant of a PduO-type ATP:corrinoid adenosyltransferase from Lactobacillus reuteri complexed with cobalamin and ATP
Assembly ID 1
Resolution 1.38Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 98
Sequence identity between the two chains 1.0
PubMed citation 19236001
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A A
UniProt accession Q50EJ2 Q50EJ2
Species 1598 (Limosilactobacillus reuteri) 1598 (Limosilactobacillus reuteri)
Function annotation BioLiP:3gajA BioLiP:3gajA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3gaj-a1-m2-cA_3gaj-a1-m3-cA.pdb.gz
Full biological assembly
Download: 3gaj-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2nt8/1/1:A/2:A 2nt8/1/1:A/3:A 2nt8/1/2:A/3:A 2r6t/1/1:A/2:A 2r6t/1/1:A/3:A 2r6t/1/2:A/3:A 2r6t/2/1:B/4:B 2r6t/2/1:B/5:B 2r6t/2/4:B/5:B 2r6x/1/1:A/2:A 2r6x/1/1:A/3:A 2r6x/1/2:A/3:A 2r6x/2/1:B/4:B 2r6x/2/1:B/5:B 2r6x/2/4:B/5:B 3ci1/1/1:A/2:A 3ci1/1/1:A/3:A 3ci1/1/2:A/3:A 3ci3/1/1:A/2:A 3ci3/1/1:A/3:A 3ci3/1/2:A/3:A 3ci4/1/1:A/2:A 3ci4/1/1:A/3:A 3ci4/1/2:A/3:A 3gah/1/1:A/2:A 3gah/1/1:A/3:A 3gah/1/2:A/3:A 3gai/1/1:A/2:A 3gai/1/1:A/3:A 3gai/1/2:A/3:A 3gaj/1/1:A/2:A 3gaj/1/1:A/3:A

[Back to Home]