3gf0/1/2:A/3:A

Sequences
>3gf0-a1-m2-cA (length=199) [Search sequence]
MILSDKDIIDYVTSKRIIIKPFNKDFVGPCSYDVTLGDEFIIYDDEVYDLSKELNYKRIK
IKNSILVCPLNYNLTEEKINYFKEKYNVDYVVEGGVLGTTNEYIELPNDISAQYQGRSSL
GRVFLTSHQTAGWIDAGFKGKITLQIVAFDKPVILYKNQRIGQLIFSKLLSPADVGYSER
KTSKYAYQKSVMPSLIHLD
>3gf0-a1-m3-cA (length=199) [Search sequence]
MILSDKDIIDYVTSKRIIIKPFNKDFVGPCSYDVTLGDEFIIYDDEVYDLSKELNYKRIK
IKNSILVCPLNYNLTEEKINYFKEKYNVDYVVEGGVLGTTNEYIELPNDISAQYQGRSSL
GRVFLTSHQTAGWIDAGFKGKITLQIVAFDKPVILYKNQRIGQLIFSKLLSPADVGYSER
KTSKYAYQKSVMPSLIHLD
Structure information
PDB ID 3gf0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Bifunctional dCTP deaminase-dUTPase mutant enzyme variant E145Q from Methanocaldococcus jannaschii in complex with pyrophosphate and magnesium
Assembly ID 1
Resolution 2.62Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 155
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A A
UniProt accession Q57872 Q57872
Species 2190 (Methanocaldococcus jannaschii) 2190 (Methanocaldococcus jannaschii)
Function annotation BioLiP:3gf0A BioLiP:3gf0A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3gf0-a1-m2-cA_3gf0-a1-m3-cA.pdb.gz
Full biological assembly
Download: 3gf0-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1ogh/1/1:A/2:A 1ogh/1/1:A/3:A 1ogh/1/2:A/3:A 1ogh/2/1:B/4:B 1ogh/2/1:B/5:B 1ogh/2/4:B/5:B 1pkh/1/1:A/2:A 1pkh/1/1:A/3:A 1pkh/1/2:A/3:A 1pkh/1/4:B/5:B 1pkh/1/4:B/6:B 1pkh/1/5:B/6:B 1pkj/1/1:B/2:B 1pkj/1/1:B/3:B 1pkj/1/2:B/3:B 1pkj/1/4:A/5:A 1pkj/1/4:A/6:A 1pkj/1/5:A/6:A 1pkj/2/1:A/7:A 1pkj/2/1:A/8:A 1pkj/2/7:A/8:A 1pkk/1/1:B/2:B 1pkk/1/1:B/3:B 1pkk/1/2:B/3:B 1pkk/1/4:A/5:A 1pkk/1/4:A/6:A 1pkk/1/5:A/6:A 1pkk/2/1:A/7:A 1pkk/2/1:A/8:A 1pkk/2/7:A/8:A 2hxb/1/1:A/2:A 2hxb/1/1:A/3:A 2hxb/1/2:A/3:A 2hxb/2/1:A/2:A 2hxb/2/1:A/3:A 2hxb/2/2:A/3:A 2hxb/2/4:A/5:A 2hxb/2/4:A/6:A 2hxb/2/5:A/6:A 2hxd/1/1:A/2:A 2hxd/1/1:A/3:A 2hxd/1/2:A/3:A 2hxd/2/1:A/2:A 2hxd/2/1:A/3:A 2hxd/2/2:A/3:A 2hxd/2/4:A/5:A 2hxd/2/4:A/6:A 2hxd/2/5:A/6:A 2hxd/3/10:A/15:A 2hxd/3/10:A/8:A 2hxd/3/11:A/14:A 2hxd/3/11:A/7:A 2hxd/3/12:A/13:A 2hxd/3/12:A/9:A 2hxd/3/13:A/9:A 2hxd/3/14:A/7:A 2hxd/3/15:A/8:A 2hxd/3/16:A/23:A 2hxd/3/16:A/26:A 2hxd/3/17:A/21:A 2hxd/3/17:A/25:A 2hxd/3/18:A/20:A 2hxd/3/18:A/27:A 2hxd/3/19:A/22:A 2hxd/3/19:A/24:A 2hxd/3/1:A/2:A 2hxd/3/1:A/3:A 2hxd/3/20:A/27:A 2hxd/3/21:A/25:A 2hxd/3/22:A/24:A 2hxd/3/23:A/26:A 2hxd/3/2:A/3:A 3gf0/1/1:A/2:A 3gf0/1/1:A/3:A
Other dimers with similar sequences but different poses
  • 2hxb/2/3:A/6:A 1pkh/1/4:B/1:A 1pkh/1/5:B/2:A 1pkh/1/6:B/3:A 1pkj/1/1:B/4:A 1pkj/1/2:B/5:A 1pkj/1/3:B/6:A 1pkk/1/1:B/4:A 1pkk/1/2:B/5:A 1pkk/1/3:B/6:A 2hxb/2/1:A/5:A 2hxb/2/2:A/4:A 2hxd/2/1:A/5:A 2hxd/2/2:A/4:A 2hxd/2/3:A/6:A
  • 1pkh/1/6:B/1:A 1pkh/1/4:B/2:A 1pkh/1/5:B/3:A 1pkj/1/1:B/5:A 1pkj/1/2:B/6:A 1pkj/1/3:B/4:A 1pkk/1/1:B/6:A 1pkk/1/2:B/4:A 1pkk/1/3:B/5:A 2hxb/2/1:A/6:A 2hxb/2/2:A/5:A 2hxb/2/3:A/4:A
  • 2hxd/3/18:A/9:A 2hxd/3/10:A/26:A 2hxd/3/11:A/27:A 2hxd/3/12:A/25:A 2hxd/3/13:A/23:A 2hxd/3/14:A/22:A 2hxd/3/15:A/21:A 2hxd/3/17:A/7:A 2hxd/3/19:A/8:A 2hxd/3/1:A/16:A 2hxd/3/20:A/3:A 2hxd/3/2:A/24:A
  • [Back to Home]