3gge/2/2:A/2:C

Sequences
>3gge-a2-m2-cA (length=95) [Search sequence]
SMKGIEKEVNVYKSEDSLGLTITDNGVGYAFIKRIKDGGVIDSVKTICVGDHIESINGEN
IVGWRHYDVAKKLKELKKEELFTMKLIEPKKSSEA
>3gge-a2-m2-cC (length=95) [Search sequence]
SMKGIEKEVNVYKSEDSLGLTITDNGVGYAFIKRIKDGGVIDSVKTICVGDHIESINGEN
IVGWRHYDVAKKLKELKKEELFTMKLIEPKKSSEA
Structure information
PDB ID 3gge (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the PDZ domain of PDZ domain-containing protein GIPC2
Assembly ID 2
Resolution 2.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 40
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A C
UniProt accession Q8TF65 Q8TF65
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3gge-a2-m2-cA_3gge-a2-m2-cC.pdb.gz
Full biological assembly
Download: 3gge-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3gge/1/1:A/1:C 3gge/2/1:A/1:C
Other dimers with similar sequences but different poses
  • 3gge/2/2:B/2:A 3gge/1/1:B/1:A 3gge/2/1:B/1:A
  • 3gge/2/2:B/2:C 3gge/1/1:B/1:C 3gge/2/1:B/1:C
  • 3gge/2/1:B/2:C 3gge/2/2:B/1:C
  • [Back to Home]