3gjp/1/1:C/1:A

Sequences
>3gjp-a1-m1-cC (length=34) [Search sequence]
GSRMKQLEDKVEELLSKNYHLENEIARIKKLVGE
>3gjp-a1-m1-cA (length=35) [Search sequence]
GSRMKQLEDKVEELLSKNYHLENEIARIKKLVGER
Structure information
PDB ID 3gjp (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of mutant coiled coil GCN4 leucine zipper
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 32
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C A
UniProt accession P03069 P03069
Species 4932 (Saccharomyces cerevisiae) 4932 (Saccharomyces cerevisiae)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3gjp-a1-m1-cC_3gjp-a1-m1-cA.pdb.gz
Full biological assembly
Download: 3gjp-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3gjp/1/1:A/1:B 3gjp/1/1:C/1:B

[Back to Home]