3gl6/1/1:A/2:A

Sequences
>3gl6-a1-m1-cA (length=52) [Search sequence]
SVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCA
>3gl6-a1-m2-cA (length=52) [Search sequence]
SVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCA
Structure information
PDB ID 3gl6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of JARID1A-PHD3 complexed with H3(1-9)K4me3 peptide
Assembly ID 1
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 62
Sequence identity between the two chains 1.0
PubMed citation 19430464
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P29375 P29375
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:3gl6A BioLiP:3gl6A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3gl6-a1-m1-cA_3gl6-a1-m2-cA.pdb.gz
Full biological assembly
Download: 3gl6-assembly1.cif.gz

[Back to Home]