3gnj/2/3:D/1:C

Sequences
>3gnj-a2-m3-cD (length=106) [Search sequence]
NASLEKLDTNTFEQLIYDEGKACLVFSRKNCHVCQKVTPVLEELRLNYEESFGFYYVDVE
EEKTLFQRFSLKGVPQILYFKDGEYKGKAGDVEDDEVEQIADVLED
>3gnj-a2-m1-cC (length=107) [Search sequence]
SNASLEKLDTNTFEQLIYDEGKACLVFSRKNCHVCQKVTPVLEELRLNYEESFGFYYVDV
EEEKTLFQRFSLKGVPQILYFKDGEYKGKAGDVEDDEVEQIADVLED
Structure information
PDB ID 3gnj (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structure of a thioredoxin-related protein from Desulfitobacterium hafniense DCB
Assembly ID 2
Resolution 1.99Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 49
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 3 1
Chain ID D C
UniProt accession B8G0E7 B8G0E7
Species 272564 (Desulfitobacterium hafniense DCB-2) 272564 (Desulfitobacterium hafniense DCB-2)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3gnj-a2-m3-cD_3gnj-a2-m1-cC.pdb.gz
Full biological assembly
Download: 3gnj-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3gnj/4/1:D/1:C 3gnj/3/1:B/1:A
  • [Back to Home]