3goc/2/1:A/1:B

Sequences

>3goc-a2-m1-cA (length=228) [Search sequence]

TTVRIPAGWPATEEEARAVQDELRGRVILDEPGPPPGTGRVTGVDVAYDDERDVVVAAAV
VLDAATLDVVAEATAVGEVSFPYVPGLLAFREIPTVLAALDALPCPPGLIVCDGYGVAHP
RRFGLASHLGVLTGLPTIGVAKNPFTFSYEDPGAPRGSAAPLLAGADEVGRALRTQSGVK
PVFVSVGHRVDLDHACAHTLALTPKYRIPETTRRADSLCRRALKEATA

>3goc-a2-m1-cB (length=228) [Search sequence]

Structure information

PDB ID	3goc (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the Endonuclease V (SAV1684) from Streptomyces avermitilis. Northeast Structural Genomics Consortium Target SvR196
Assembly ID	2
Resolution	1.6Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	48
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q82MH6	Q82MH6
Species	227882 (Streptomyces avermitilis MA-4680 = NBRC 14893)	227882 (Streptomyces avermitilis MA-4680 = NBRC 14893)
Function annotation	BioLiP:3gocA	BioLiP:3gocB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3goc-a2-m1-cA_3goc-a2-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3goc-assembly2.cif.gz

Similar dimers