3gud/2/4:B/5:B

Sequences
>3gud-a2-m4-cB (length=120) [Search sequence]
SDERHKTDIAPISDKVLDAWEKVKFYQYKFKDAVDEKGEEARYHFGVIAQQIVKVFEDEG
LSAFDYGLVGYDEWEATEDEYDSEGNLVEKGREAGNIYSIRPTECQWLEMACMRRKLERL
>3gud-a2-m5-cB (length=120) [Search sequence]
SDERHKTDIAPISDKVLDAWEKVKFYQYKFKDAVDEKGEEARYHFGVIAQQIVKVFEDEG
LSAFDYGLVGYDEWEATEDEYDSEGNLVEKGREAGNIYSIRPTECQWLEMACMRRKLERL
Structure information
PDB ID 3gud (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a novel intramolecular chaperon
Assembly ID 2
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 87
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 4 5
Chain ID B B
UniProt accession Q9FZW3 Q9FZW3
Species 12345 (Gaunavirus GA1) 12345 (Gaunavirus GA1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3gud-a2-m4-cB_3gud-a2-m5-cB.pdb.gz
Full biological assembly
Download: 3gud-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3gud/1/1:A/2:A 3gud/1/1:A/3:A 3gud/1/2:A/3:A 3gud/2/1:B/4:B 3gud/2/1:B/5:B

[Back to Home]