3gxq/1/1:A/1:B

Sequences
>3gxq-a1-m1-cA (length=53) [Search sequence]
NSVFFGKKKKVSLHLLVDPDMKDEIIKYAQEKDFDNVSQAGREILKKGLEQIA
>3gxq-a1-m1-cB (length=54) [Search sequence]
ENSVFFGKKKKVSLHLLVDPDMKDEIIKYAQEKDFDNVSQAGREILKKGLEQIA
Structure information
PDB ID 3gxq (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of ArtA and DNA complex
Assembly ID 1
Resolution 2.35Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 109
Sequence identity between the two chains 1.0
PubMed citation 19759211
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession A0A0H2XIU6 A0A0H2XIU6
Species 367830 (Staphylococcus aureus subsp. aureus USA300) 367830 (Staphylococcus aureus subsp. aureus USA300)
Function annotation BioLiP:3gxqA BioLiP:3gxqB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3gxq-a1-m1-cA_3gxq-a1-m1-cB.pdb.gz
Full biological assembly
Download: 3gxq-assembly1.cif.gz

[Back to Home]