3h7x/1/1:B/1:C

Sequences
>3h7x-a1-m1-cB (length=51) [Search sequence]
HTLKTANSYTDVTVSNSTKKAIRESNQYTDHKFHQLDNRLDKLDTRVDKGL
>3h7x-a1-m1-cC (length=51) [Search sequence]
TLKTANSYTDVTVSNSTKKAIRESNQYTDHKFHQLDNRLDKLDTRVDKGLA
Structure information
PDB ID 3h7x (database links: RCSB PDB PDBe PDBj PDBsum)
Title A transition from strong right-handed to canonical left-handed supercoiling in a conserved coiled coil segment of trimeric autotransporter adhesins - the wildtype structure
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 61
Sequence identity between the two chains 0.98
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession P0C2W0 P0C2W0
Species 630 (Yersinia enterocolitica) 630 (Yersinia enterocolitica)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3h7x-a1-m1-cB_3h7x-a1-m1-cC.pdb.gz
Full biological assembly
Download: 3h7x-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3h7x/1/1:C/1:A 3h7x/2/1:E/1:F
Other dimers with similar sequences but different poses
  • 3h7z/1/2:A/3:A 3h7x/1/1:B/1:A 3h7z/1/1:A/2:A 3h7z/1/1:A/3:A 3lt6/1/1:C/1:B 3lt6/2/1:D/1:F 3lt7/1/1:C/1:B 3lt7/2/1:F/1:E
  • [Back to Home]