3h7z/1/2:A/3:A

Sequences
>3h7z-a1-m2-cA (length=61) [Search sequence]
HTLKTANSYTDVTVSNSTKKAIRESNQYTDHKFHQLDNRLDKLDTRLLKLLASSAALNSL
L
>3h7z-a1-m3-cA (length=61) [Search sequence]
HTLKTANSYTDVTVSNSTKKAIRESNQYTDHKFHQLDNRLDKLDTRLLKLLASSAALNSL
L
Structure information
PDB ID 3h7z (database links: RCSB PDB PDBe PDBj PDBsum)
Title A transition from strong right-handed to canonical left-handed supercoiling in a conserved coiled coil segment of trimeric autotransporter adhesins - the M1 mutant structure
Assembly ID 1
Resolution 2.51Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 66
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A A
UniProt accession P0C2W0 P0C2W0
Species 630 (Yersinia enterocolitica) 630 (Yersinia enterocolitica)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 3h7z-a1-m2-cA_3h7z-a1-m3-cA.pdb.gz
Full biological assembly
Download: 3h7z-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3h7x/1/1:B/1:A 3h7z/1/1:A/2:A 3h7z/1/1:A/3:A 3lt6/1/1:C/1:B 3lt6/2/1:D/1:F 3lt7/1/1:C/1:B 3lt7/2/1:F/1:E
Other dimers with similar sequences but different poses
  • 3h7x/1/1:B/1:C 3h7x/1/1:C/1:A 3h7x/2/1:E/1:F
  • [Back to Home]