3h90/1/1:A/1:C

Sequences

>3h90-a1-m1-cA (length=283) [Search sequence]

LVSRAAIAATAMASLLLLIKIFAWWYTGSVSILAALVDSLVDIGASLTNLLVVRYSLQPA
DDNHSFGHGKAESLAALAQSMFISGSALFLFLTGIQHLISPTPMTDPGVGVIVTIVALIC
TIILVSFQRWVVRRTQSQAVRADMLHYQSDVMMNGAILLALGLSWYGWHRADALFALGIG
IYILYSALRMGYEAVQSLLDRALPDEERQEIIDIVTSWPGVSGAHDLRTRQSGPTRFIQI
HLEMEDSLPLVQAHMVADQVEQAILRRFPGSDVIIHQDPCSVV

>3h90-a1-m1-cC (length=283) [Search sequence]

Structure information

PDB ID	3h90 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structural basis for the autoregulation of the zinc transporter YiiP
Assembly ID	1
Resolution	2.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	112
Sequence identity between the two chains	1.0
PubMed citation	19749753

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	C
UniProt accession	P69380	P69380
Species	83333 (Escherichia coli K-12)	83333 (Escherichia coli K-12)
Function annotation	BioLiP:3h90A	BioLiP:3h90C

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	3h90-a1-m1-cA_3h90-a1-m1-cC.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	3h90-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2qfi/1/1:A/2:A 2qfi/2/1:B/3:B 3h90/2/1:B/1:D