3h91/3/1:B/2:B

Sequences
>3h91-a3-m1-cB (length=52) [Search sequence]
EQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQK
>3h91-a3-m2-cB (length=52) [Search sequence]
EQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQK
Structure information
PDB ID 3h91 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the complex of human chromobox homolog 2 (CBX2) and H3K27 peptide
Assembly ID 3
Resolution 1.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 25
Sequence identity between the two chains 1.0
PubMed citation 21047797
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B B
UniProt accession Q14781 Q14781
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:3h91B BioLiP:3h91B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3h91-a3-m1-cB_3h91-a3-m2-cB.pdb.gz
Full biological assembly
Download: 3h91-assembly3.cif.gz
Similar dimers

[Back to Home]