3hdg/4/1:B/2:E

Sequences
>3hdg-a4-m1-cB (length=119) [Search sequence]
VALKILIVEDDTDAREWLSTIISNHFPEVWSAGDGEEGERLFGLHAPDVIITDIRPKLGG
LELDRIKAGGAKPYVIVISSEKYFIKAIELGVHLFLPKPIEPGRLETLEDFRHIKLAKE
>3hdg-a4-m2-cE (length=120) [Search sequence]
ALKILIVEDDTDAREWLSTIISNHFPEVWSAGDGEEGERLFGLHAPDVIITDIRPKLGGL
ELDRIKAGGAKPYVIVISAFSEKYFIKAIELGVHLFLPKPIEPGRLETLEDFRHIKLAKE
Structure information
PDB ID 3hdg (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the N-terminal domain of an uncharacterized protein (WS1339) from Wolinella succinogenes
Assembly ID 4
Resolution 2.27Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 33
Sequence identity between the two chains 0.992
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B E
UniProt accession Q7MRH8 Q7MRH8
Species 844 (Wolinella succinogenes) 844 (Wolinella succinogenes)
Function annotation BioLiP:3hdgB BioLiP:3hdgE
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 3hdg-a4-m1-cB_3hdg-a4-m2-cE.pdb.gz
Full biological assembly
Download: 3hdg-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3hdg/2/1:D/1:E 3hdg/1/1:B/1:A
  • [Back to Home]